PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010548834.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 297aa    MW: 32640.6 Da    PI: 10.8351
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010548834.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.5e-1486131247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++WT+eE+  ++ + k+lG+g+W+ I++++  +Rt+ q+ s+ qky
   XP_010548834.1  86 KPWTEEEHRTFLAGLKLLGKGDWRGISKKFVVTRTPTQVASHAQKY 131
                      58*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.25180136IPR017930Myb domain
SuperFamilySSF466891.42E-1682136IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-1783135IPR006447Myb domain, plants
SMARTSM007172.2E-1184134IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-1184130IPR009057Homeodomain-like
PfamPF002497.3E-1286131IPR001005SANT/Myb domain
CDDcd001671.14E-987132No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MVKTCSPCDN ARTILNGVNK PCVKLFGVNI SAPEPEGLTA LRKSLSLGNL RSLDVSAAAA  60
EDPGYLSDGL VGSKKGKSAR EKKKGKPWTE EEHRTFLAGL KLLGKGDWRG ISKKFVVTRT  120
PTQVASHAQK YFLRQNAGDK RKRRASLFDI PLTFNSEDSN PERASAVALE APKTLPEASS  180
SSSAKPTTLQ REPVRGRAQF EILNPFQNPR MGYRPIYRTI QSHYPAPSLI FPQMFHYARA  240
RPVHPSGIPA PRHIPTGMPL SLVDPLTEKD SLELQIRPPR PPMSPRASQA LGAIHVK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010548834.10.0PREDICTED: transcription factor MYB1R1-like
TrEMBLD7MV436e-93D7MV43_ARALL; Myb family transcription factor
STRINGfgenesh2_kg.8__2146__AT5G61620.12e-92(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60212747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.11e-82MYB_related family protein